Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YES1 Rabbit Polyclonal Antibody (FITC)

YES1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Yes, c-yes, HsT441, P61-YES

UniProt

P07947

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTA

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC

NCBI Accession Number

NP_005424

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Catsperg2 shRNA (UAS) - Lentiviral mouse Catsperg2 shRNA (UAS) (100)
GTR15193290 1 Vial

Lentiviral mouse Catsperg2 shRNA (UAS) - Lentiviral mouse Catsperg2 shRNA (UAS) (100)

Sign In for Pricing
View Details
POM121L7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1686607 1.0 µg DNA

POM121L7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Respiratory Syncytial Virus, Fusion Protein (RSV) (APC) discontinued
R1600-03-APC 100 µL

Respiratory Syncytial Virus, Fusion Protein (RSV) (APC) discontinued

Sign In for Pricing
View Details
GALNT10 discontinued
530728-01 20 µL

GALNT10 discontinued

Sign In for Pricing
View Details
GALNT10 discontinued
530728-02 100 µL

GALNT10 discontinued

Sign In for Pricing
View Details
CBX4 Mouse Monoclonal Antibody
orb2956904-01 50 µg

CBX4 Mouse Monoclonal Antibody

Sign In for Pricing
View Details