Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OAF Rabbit Polyclonal Antibody (HRP)

OAF Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NS5ATP13TP2

UniProt

Q86UD1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human OAF

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVSF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_848602

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse LHCGR Protein, His (Fc)-Avi-tagged
LHCGR-5067M 50 µg

Recombinant Mouse LHCGR Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Mouse ADP-ribosylation factor GTPase-activating protein 1 (ARFGAP1) ELISA Kit
MBS7204461-01 48 Well

Mouse ADP-ribosylation factor GTPase-activating protein 1 (ARFGAP1) ELISA Kit

Sign In for Pricing
View Details
Mouse ADP-ribosylation factor GTPase-activating protein 1 (ARFGAP1) ELISA Kit
MBS7204461-02 96 Well

Mouse ADP-ribosylation factor GTPase-activating protein 1 (ARFGAP1) ELISA Kit

Sign In for Pricing
View Details
Mouse ADP-ribosylation factor GTPase-activating protein 1 (ARFGAP1) ELISA Kit
MBS7204461-03 5x 96 Well

Mouse ADP-ribosylation factor GTPase-activating protein 1 (ARFGAP1) ELISA Kit

Sign In for Pricing
View Details
Mouse ADP-ribosylation factor GTPase-activating protein 1 (ARFGAP1) ELISA Kit
MBS7204461-04 10x 96 Well

Mouse ADP-ribosylation factor GTPase-activating protein 1 (ARFGAP1) ELISA Kit

Sign In for Pricing
View Details
RNF5 Antibody
A66187-50UL 50 μL

RNF5 Antibody

Sign In for Pricing
View Details