Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THEMIS Rabbit Polyclonal Antibody (HRP)

THEMIS Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GASP, SPOT, TSEPA, C6orf190, C6orf207

UniProt

Q8N1K5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RHHVDITKKLHPNQAGLDSKVLIGSQNDLVDEEKERSNRGATAIAETFKN

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001158159

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgM Immunoglobulin (IM373), CF405S conjugate, 0.1mg/mL
BNC040373-500 1x 500 µL

Human IgM Immunoglobulin (IM373), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chk1 (CHEK1) Sheep Polyclonal Antibody
AP05017PU-N 250 µg

Chk1 (CHEK1) Sheep Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Component C3a protein (TRX, His tag)
PDEM100242-01 20 µg

Recombinant Mouse Component C3a protein (TRX, His tag)

Sign In for Pricing
View Details
Recombinant Mouse Component C3a protein (TRX, His tag)
PDEM100242-02 100 µg

Recombinant Mouse Component C3a protein (TRX, His tag)

Sign In for Pricing
View Details
Recombinant Mouse Component C3a protein (TRX, His tag)
PDEM100242-03 500 µg

Recombinant Mouse Component C3a protein (TRX, His tag)

Sign In for Pricing
View Details
Recombinant Mouse Component C3a protein (TRX, His tag)
PDEM100242-04 1 mg

Recombinant Mouse Component C3a protein (TRX, His tag)

Sign In for Pricing
View Details