Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTBS Rabbit Polyclonal Antibody (HRP)

CTBS Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CTB

UniProt

Q01459

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WYGYDYTCLNLSEDHVCTIAKVPFRGAPCSDAAGRQVPYKTIMKQINSSI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004379

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALNT9 Rabbit Polyclonal Antibody (FITC)
orb2113812 100 µL

GALNT9 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
GNG5P4 3'UTR GFP Stable Cell Line
TU058998 1.0 mL

GNG5P4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MEK2/MAP2K2 Rabbit Polyclonal Antibody (Fluoro550)
orb3115903 100 µg

MEK2/MAP2K2 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Zebrafish RAB1aa/ab Rabbit Polyclonal Antibody (FITC)
orb2817502 100 µg

Zebrafish RAB1aa/ab Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
HOXD8 (Homeobox D8, Homeobox Protein Hox-D8, Homeobox Protein Hox-4E, HOX4E, HOX4, Homeobox Protein Hox-5.4, HOX5.4) (MaxLight 405) discontinued
128051-ML405 100 µL

HOXD8 (Homeobox D8, Homeobox Protein Hox-D8, Homeobox Protein Hox-4E, HOX4E, HOX4, Homeobox Protein Hox-5.4, HOX5.4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal LIR-8/CD85c/LILRB5 Antibody [Alexa Fluor 488]
NBP2-98702AF488 0.1 mL

Rabbit Polyclonal LIR-8/CD85c/LILRB5 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details