Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFSF8 Rabbit Polyclonal Antibody (HRP)

TNFSF8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CD153, CD30L, CD30LG, TNLG3A

UniProt

P32971

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQV

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001235

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ankrd52 Mouse Gene Knockout Kit (CRISPR)
KN501297 1 Kit

Ankrd52 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tiropramide Hydrochloride
TRC-T446900-25MG 25 mg

Tiropramide Hydrochloride

Sign In for Pricing
View Details
ZD 7114 Hydrochloride
TRC-Z157505-100MG 100 mg

ZD 7114 Hydrochloride

Sign In for Pricing
View Details
Mouse Bmp5 activation kit by CRISPRa
GA200420 1 Kit

Mouse Bmp5 activation kit by CRISPRa

Sign In for Pricing
View Details
Human TGF-alpha, Tag Free
HA211318-01 20 µg

Human TGF-alpha, Tag Free

Sign In for Pricing
View Details
Human TGF-alpha, Tag Free
HA211318-02 50 µg

Human TGF-alpha, Tag Free

Sign In for Pricing
View Details