Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PANK2 Rabbit Polyclonal Antibody (Biotin)

PANK2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HSS, HARP, PKAN, NBIA1, C20orf48

UniProt

Q9BZ23

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PANK2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human HLA-DP Monomorphic Antibody (SAA0108), PE
MBS1585550-01 50 Tests

Anti-Human HLA-DP Monomorphic Antibody (SAA0108), PE

Sign In for Pricing
View Details
Anti-Human HLA-DP Monomorphic Antibody (SAA0108), PE
MBS1585550-02 100 Tests

Anti-Human HLA-DP Monomorphic Antibody (SAA0108), PE

Sign In for Pricing
View Details
Anti-Human HLA-DP Monomorphic Antibody (SAA0108), PE
MBS1585550-03 5x 100 Tests

Anti-Human HLA-DP Monomorphic Antibody (SAA0108), PE

Sign In for Pricing
View Details
TP53 Rabbit Polyclonal Antibody (HRP)
orb2144724 100 µL

TP53 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
FKBP3 (FK506-binding Protein 3, Peptidyl-prolyl Cis-trans Isomerase FKBP3, PPIase FKBP3, Rotamase, 25kD FKBP, FKBP-25, 25kD FK506-binding Protein, Rapamycin-selective 25kD Immunophilin, FKBP25) (MaxLight 405) discontinued
126831-ML405 100 µL

FKBP3 (FK506-binding Protein 3, Peptidyl-prolyl Cis-trans Isomerase FKBP3, PPIase FKBP3, Rotamase, 25kD FKBP, FKBP-25, 25kD FK506-binding Protein, Rapamycin-selective 25kD Immunophilin, FKBP25) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PALM2 (Paralemmin 2, Paralemmin-2) (MaxLight 490)
130851-ML490 100 µL

PALM2 (Paralemmin 2, Paralemmin-2) (MaxLight 490)

Sign In for Pricing
View Details