Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PANK2 Rabbit Polyclonal Antibody (HRP)

PANK2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HSS, HARP, PKAN, NBIA1, C20orf48

UniProt

Q9BZ23

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PANK2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbm15 Mouse Pre-designed siRNA Set A
HY-RS19032 1 Set

Rbm15 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) GET4 Polyclonal Antibody
MBS7190324 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) GET4 Polyclonal Antibody

Sign In for Pricing
View Details
SRPRB Polyclonal Antibody
MBS2542443-01 0.02 mL

SRPRB Polyclonal Antibody

Sign In for Pricing
View Details
SRPRB Polyclonal Antibody
MBS2542443-02 0.06 mL

SRPRB Polyclonal Antibody

Sign In for Pricing
View Details
SRPRB Polyclonal Antibody
MBS2542443-03 0.12 mL

SRPRB Polyclonal Antibody

Sign In for Pricing
View Details
SRPRB Polyclonal Antibody
MBS2542443-04 0.2 mL

SRPRB Polyclonal Antibody

Sign In for Pricing
View Details