Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHA7 Rabbit Polyclonal Antibody (Biotin)

EPHA7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EHK3, EK11, EHK-3, HEK11

UniProt

Q15375

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPHA7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGIL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

112kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004431

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Interleukin 17, IL-17 ELISA Kit
CSB-E13097Gp-01 24 Well

Guinea pig Interleukin 17, IL-17 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Interleukin 17, IL-17 ELISA Kit
CSB-E13097Gp-02 96 Well

Guinea pig Interleukin 17, IL-17 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Interleukin 17, IL-17 ELISA Kit
CSB-E13097Gp-03 5x 96 Well

Guinea pig Interleukin 17, IL-17 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Interleukin 17, IL-17 ELISA Kit
CSB-E13097Gp-04 10x 96 Well

Guinea pig Interleukin 17, IL-17 ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal CCR7 Antibody (4B12) [mFluor Violet 500 SE]
NBP3-12012MFV500 0.1 mL

Rabbit Monoclonal CCR7 Antibody (4B12) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Rabbit nitric oxide (NO) ELISA Kit
EIA06120Rb 1 Kit

Rabbit nitric oxide (NO) ELISA Kit

Sign In for Pricing
View Details