Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR3DS1 Rabbit Polyclonal Antibody (Biotin)

KIR3DS1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KIR-G1, NKAT10, CD158E2, NKAT-10, KIR-123FM

UniProt

Q14943

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KIR3DS1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADF

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001077008

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-hsa-miR-615-3p-Off Virus
mh6079 1.0 mL

AdmiRa-hsa-miR-615-3p-Off Virus

Sign In for Pricing
View Details
Rabbit Monoclonal Podoplanin Antibody (066) [Alexa Fluor 488]
NBP2-89552AF488 0.1 mL

Rabbit Monoclonal Podoplanin Antibody (066) [Alexa Fluor 488]

Sign In for Pricing
View Details
SERS Recombinant Protein (Human)
OPCA00540-100UG 100 µg

SERS Recombinant Protein (Human)

Sign In for Pricing
View Details
ABCC10, ID (ABCC10, MRP7, SIMRP7, Multidrug resistance-associated protein 7, ATP-binding cassette sub-family C member 10) (AP)
MBS6270408-01 0.2 mL

ABCC10, ID (ABCC10, MRP7, SIMRP7, Multidrug resistance-associated protein 7, ATP-binding cassette sub-family C member 10) (AP)

Sign In for Pricing
View Details
ABCC10, ID (ABCC10, MRP7, SIMRP7, Multidrug resistance-associated protein 7, ATP-binding cassette sub-family C member 10) (AP)
MBS6270408-02 5x 0.2 mL

ABCC10, ID (ABCC10, MRP7, SIMRP7, Multidrug resistance-associated protein 7, ATP-binding cassette sub-family C member 10) (AP)

Sign In for Pricing
View Details
Coiled-Coil Domain Containing 184 (CCDC184) Antibody (Biotin)
abx307340-01 20 µg

Coiled-Coil Domain Containing 184 (CCDC184) Antibody (Biotin)

Sign In for Pricing
View Details