Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR3DS1 Rabbit Polyclonal Antibody (FITC)

KIR3DS1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KIR-G1, NKAT10, CD158E2, NKAT-10, KIR-123FM

UniProt

Q14943

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KIR3DS1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADF

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001077008

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKKB, phosphorylated (S177) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (MaxLight 405) discontinued
036953-ML405 100 µL

IKKB, phosphorylated (S177) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Phalloidin - AcalephFluor488
orb3073477-01 50 assay

Phalloidin - AcalephFluor488

Sign In for Pricing
View Details
Phalloidin - AcalephFluor488
orb3073477-02 300 assay

Phalloidin - AcalephFluor488

Sign In for Pricing
View Details
CKM (Creatine Kinase, Muscle, CKMM, M-CK)
244718 200 µL

CKM (Creatine Kinase, Muscle, CKMM, M-CK)

Sign In for Pricing
View Details
NBPF6 Peptide
DF9685-BP 1 mg

NBPF6 Peptide

Sign In for Pricing
View Details
TRIM10 Antibody / Tripartite motif-containing protein 10
FY12258 100 µg

TRIM10 Antibody / Tripartite motif-containing protein 10

Sign In for Pricing
View Details