Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCG5 Rabbit Polyclonal Antibody (FITC)

SCG5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

7B2, SgV, P7B2, SGNE1

UniProt

P05408

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVA

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001138229

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ETS1 (Phospho-Thr38) Polyclonal Conjugated Antibody
orb1630864 100 µL

ETS1 (Phospho-Thr38) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
ALDH8A1, CT (Aldehyde Dehydrogenase Family 8 Member A1, Aldehyde Dehydrogenase 12, ALDH12) (Biotin) discontinued
A1334-38-Biotin 200 µL

ALDH8A1, CT (Aldehyde Dehydrogenase Family 8 Member A1, Aldehyde Dehydrogenase 12, ALDH12) (Biotin) discontinued

Sign In for Pricing
View Details
CADM3 Protein (C-His, Human)
P513607 100 µg

CADM3 Protein (C-His, Human)

Sign In for Pricing
View Details
Rat Acetylcholinesterase ELISA Kit
orb1660396 96 Tests

Rat Acetylcholinesterase ELISA Kit

Sign In for Pricing
View Details
C7orf16 (PPP1R17, C7orf16, GSBS, Protein Phosphatase 1 Regulatory Subunit 17, G-substrate) (MaxLight 490)
MBS6199833-01 0.1 mL

C7orf16 (PPP1R17, C7orf16, GSBS, Protein Phosphatase 1 Regulatory Subunit 17, G-substrate) (MaxLight 490)

Sign In for Pricing
View Details
C7orf16 (PPP1R17, C7orf16, GSBS, Protein Phosphatase 1 Regulatory Subunit 17, G-substrate) (MaxLight 490)
MBS6199833-02 5x 0.1 mL

C7orf16 (PPP1R17, C7orf16, GSBS, Protein Phosphatase 1 Regulatory Subunit 17, G-substrate) (MaxLight 490)

Sign In for Pricing
View Details