Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCG5 Rabbit Polyclonal Antibody (HRP)

SCG5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

7B2, SgV, P7B2, SGNE1

UniProt

P05408

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNP

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001138229

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PUM2, NT (Pumilio 2, Pumilio Homolog 2, Pumilio-2, KIAA0235, PUMH2) (MaxLight 550) discontinued
P9196-80E-ML550 100 µL

PUM2, NT (Pumilio 2, Pumilio Homolog 2, Pumilio-2, KIAA0235, PUMH2) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Human Flotillin-1 ELISA Kit
MBS9426742-01 96 Tests

Human Flotillin-1 ELISA Kit

Sign In for Pricing
View Details
Human Flotillin-1 ELISA Kit
MBS9426742-02 5x 96 Tests

Human Flotillin-1 ELISA Kit

Sign In for Pricing
View Details
Recombinant Enolase, Neuron Specific (NSE)
MBS2010034-01 0.01 mg

Recombinant Enolase, Neuron Specific (NSE)

Sign In for Pricing
View Details
Recombinant Enolase, Neuron Specific (NSE)
MBS2010034-02 0.05 mg

Recombinant Enolase, Neuron Specific (NSE)

Sign In for Pricing
View Details
Recombinant Enolase, Neuron Specific (NSE)
MBS2010034-03 0.1 mg

Recombinant Enolase, Neuron Specific (NSE)

Sign In for Pricing
View Details