Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAP2 Rabbit Polyclonal Antibody (Biotin)

CAP2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P40123

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GPPPLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_006357

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ACADSB Recombinant Protein
PROTP45954-10ug 10 µg

Human ACADSB Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human CAMK1G shRNA (UAS) - Lentiviral human CAMK1G shRNA (UAS, GFP) (25)
GTR15152768 1 Vial

Lentiviral human CAMK1G shRNA (UAS) - Lentiviral human CAMK1G shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
pH 7.5 Dibasic K/Monobasic Na Phosphate acc USP - 500ML
USP9705 500 mL

pH 7.5 Dibasic K/Monobasic Na Phosphate acc USP - 500ML

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Phospholipase A2 Receptor 1 (PLA2R1)
MBS2095546-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Phospholipase A2 Receptor 1 (PLA2R1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Phospholipase A2 Receptor 1 (PLA2R1)
MBS2095546-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Phospholipase A2 Receptor 1 (PLA2R1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Phospholipase A2 Receptor 1 (PLA2R1)
MBS2095546-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Phospholipase A2 Receptor 1 (PLA2R1)

Sign In for Pricing
View Details