Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAP2 Rabbit Polyclonal Antibody (FITC)

CAP2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P40123

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GPPPLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_006357

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALKBH1 discontinued
385707 200 µL

ALKBH1 discontinued

Sign In for Pricing
View Details
RAI14 Antibody, HRP conjugated
CSB-PA868376LB01HU-01 50 µg

RAI14 Antibody, HRP conjugated

Sign In for Pricing
View Details
RAI14 Antibody, HRP conjugated
CSB-PA868376LB01HU-02 100 µg

RAI14 Antibody, HRP conjugated

Sign In for Pricing
View Details
SMNDC1 (Survival Motor Neuron Domain-containing Protein 1, 30kD Splicing Factor SMNrp, SMN-related Protein, SMNR, Survival of Motor Neuron-related-splicing Factor 30, SPF30) (Biotin)
133574-Biotin 100 µL

SMNDC1 (Survival Motor Neuron Domain-containing Protein 1, 30kD Splicing Factor SMNrp, SMN-related Protein, SMNR, Survival of Motor Neuron-related-splicing Factor 30, SPF30) (Biotin)

Sign In for Pricing
View Details
Culture Medium for Human Embryonic Kidney Cells [293FT]
AFG-ELL-2778-01 125 mL

Culture Medium for Human Embryonic Kidney Cells [293FT]

Sign In for Pricing
View Details
Culture Medium for Human Embryonic Kidney Cells [293FT]
AFG-ELL-2778-02 500 mL

Culture Medium for Human Embryonic Kidney Cells [293FT]

Sign In for Pricing
View Details