Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCPH1 Rabbit Polyclonal Antibody (HRP)

MCPH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MCT, BRIT1

UniProt

E9PH63

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MCPH1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EAVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBTPS2 (S2P, Membrane-bound Transcription Factor Site-2 Protease, Endopeptidase S2P, Sterol Regulatory Element-binding Proteins Intramembrane Protease, FLJ32174) (MaxLight 490)
129474-ML490 100 µL

MBTPS2 (S2P, Membrane-bound Transcription Factor Site-2 Protease, Endopeptidase S2P, Sterol Regulatory Element-binding Proteins Intramembrane Protease, FLJ32174) (MaxLight 490)

Sign In for Pricing
View Details
RBM41 Lentiviral Activation Particles (m)
sc-433533-LAC 200 µL

RBM41 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
LIPI (Lipase Member I, LIPI, 311-, Cancer/Testis antigen 17, CT17, LPD Lipase, Membrane-Associated Phosphatidic Acid-Selective PhosphoLipase A1-beta, mPA-PLA1 beta, LIPI, LPDL) (FITC) discontinued
302530-FITC 200 µL

LIPI (Lipase Member I, LIPI, 311-, Cancer/Testis antigen 17, CT17, LPD Lipase, Membrane-Associated Phosphatidic Acid-Selective PhosphoLipase A1-beta, mPA-PLA1 beta, LIPI, LPDL) (FITC) discontinued

Sign In for Pricing
View Details
LOC686456 3'UTR GFP Stable Cell Line
TU261439 1.0 mL

LOC686456 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Beta III Tubulin Antibody
48012-01 50 µL

Beta III Tubulin Antibody

Sign In for Pricing
View Details
Beta III Tubulin Antibody
48012-02 100 µL

Beta III Tubulin Antibody

Sign In for Pricing
View Details