Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bmp5 Rabbit Polyclonal Antibody (Biotin)

Bmp5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

D4A7P9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Bmp5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NKSSSHQDPSRIPSAGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001101638

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGB1 Rabbit Polyclonal Antibody (APC)
orb2440424 100 µL

HMGB1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Mouse Trichinella spiralis IgG ELISA Kit
MBS1610252-01 96 Strip Well

Mouse Trichinella spiralis IgG ELISA Kit

Sign In for Pricing
View Details
Mouse Trichinella spiralis IgG ELISA Kit
MBS1610252-02 5x 96 Strip Well

Mouse Trichinella spiralis IgG ELISA Kit

Sign In for Pricing
View Details
Mouse Trichinella spiralis IgG ELISA Kit
MBS1610252-03 10x 96 Strip Well

Mouse Trichinella spiralis IgG ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Polr1a shRNA (UAS) - Lentiviral mouse Polr1a shRNA (UAS, GFP) plasmid
GTR15196438 1 Vial

Lentiviral mouse Polr1a shRNA (UAS) - Lentiviral mouse Polr1a shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
RREB1 Antibody
MBS7120506-01 0.05 mg

RREB1 Antibody

Sign In for Pricing
View Details