Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA1B Rabbit Polyclonal Antibody (Biotin)

HSPA1B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HSP72, HSPA1, HSX70, HSP70-1, HSP70-2, HSP70.1, HSP70.2, HSP70-1B

UniProt

P08107

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Early Growth Response 1 (EGR1) ELISA Kit
abx364445 96 Well

Sheep Early Growth Response 1 (EGR1) ELISA Kit

Sign In for Pricing
View Details
Dppa1 ORF Vector (Mouse) (pORF)
ORF043323 1.0 µg DNA

Dppa1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rat Factor Ⅷ-related Antigen (FⅧAg) ELISA Kit
GA-E0220RT-01 48 Tests

Rat Factor Ⅷ-related Antigen (FⅧAg) ELISA Kit

Sign In for Pricing
View Details
Rat Factor Ⅷ-related Antigen (FⅧAg) ELISA Kit
GA-E0220RT-02 96 Tests

Rat Factor Ⅷ-related Antigen (FⅧAg) ELISA Kit

Sign In for Pricing
View Details
Rat Twf2 Pre-designed siRNA Set A
SI215435A 1 Each

Rat Twf2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
IRGM1 siRNA (Mouse)
orb1847291-01 15 nmol

IRGM1 siRNA (Mouse)

Sign In for Pricing
View Details