Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCAR2 Rabbit Polyclonal Antibody (Biotin)

HCAR2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HCA2, HM74a, HM74b, PUMAG, NIACR1, Puma-g, GPR109A

UniProt

Q8TDS4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YYFSSPSFPNFFSTLINRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_808219

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fascin Rabbit mAb
MBS9470464-01 0.05 mL

Fascin Rabbit mAb

Sign In for Pricing
View Details
Fascin Rabbit mAb
MBS9470464-02 0.1 mL

Fascin Rabbit mAb

Sign In for Pricing
View Details
Fascin Rabbit mAb
MBS9470464-03 5x 0.1 mL

Fascin Rabbit mAb

Sign In for Pricing
View Details
CASZ1, CT (CASZ1, CST, SRG, ZNF693, Zinc finger protein castor homolog 1, Castor-related protein, Putative survival-related protein, Zinc finger protein 693) (MaxLight 750)
MBS6281000-01 0.1 mL

CASZ1, CT (CASZ1, CST, SRG, ZNF693, Zinc finger protein castor homolog 1, Castor-related protein, Putative survival-related protein, Zinc finger protein 693) (MaxLight 750)

Sign In for Pricing
View Details
CASZ1, CT (CASZ1, CST, SRG, ZNF693, Zinc finger protein castor homolog 1, Castor-related protein, Putative survival-related protein, Zinc finger protein 693) (MaxLight 750)
MBS6281000-02 5x 0.1 mL

CASZ1, CT (CASZ1, CST, SRG, ZNF693, Zinc finger protein castor homolog 1, Castor-related protein, Putative survival-related protein, Zinc finger protein 693) (MaxLight 750)

Sign In for Pricing
View Details
Mouse Signal Transducer And Activator of Transcription 6 (STAT6) ELISA Kit-Sandwich
EK6F851-01 48 Test

Mouse Signal Transducer And Activator of Transcription 6 (STAT6) ELISA Kit-Sandwich

Sign In for Pricing
View Details