Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QKI Rabbit Polyclonal Antibody (FITC)

QKI Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

QK, Hqk, QK1, QK3, hqkI

UniProt

Q96PU8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_996735

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGMS2, CT (SGMS2, SMS2, Phosphatidylcholine:ceramide cholinephosphotransferase 2, Sphingomyelin synthase 2) (PE)
MBS6347031-01 0.2 mL

SGMS2, CT (SGMS2, SMS2, Phosphatidylcholine:ceramide cholinephosphotransferase 2, Sphingomyelin synthase 2) (PE)

Sign In for Pricing
View Details
SGMS2, CT (SGMS2, SMS2, Phosphatidylcholine:ceramide cholinephosphotransferase 2, Sphingomyelin synthase 2) (PE)
MBS6347031-02 5x 0.2 mL

SGMS2, CT (SGMS2, SMS2, Phosphatidylcholine:ceramide cholinephosphotransferase 2, Sphingomyelin synthase 2) (PE)

Sign In for Pricing
View Details
SP6 Rabbit Polyclonal Antibody (Carrier-free)
orb3098341 100 µg

SP6 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
CD300LF Protein Vector (Human) (pPM-C-HA)
PV068231 500 ng

CD300LF Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mini Samples Creatine Kinase MB Isoenzyme (CKMB) ELISA Kit
MBS2709396-01 24 Strip Well

Mini Samples Creatine Kinase MB Isoenzyme (CKMB) ELISA Kit

Sign In for Pricing
View Details
Mini Samples Creatine Kinase MB Isoenzyme (CKMB) ELISA Kit
MBS2709396-02 48 Well

Mini Samples Creatine Kinase MB Isoenzyme (CKMB) ELISA Kit

Sign In for Pricing
View Details