Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QKI Rabbit Polyclonal Antibody (HRP)

QKI Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

QK, Hqk, QK1, QK3, hqkI

UniProt

Q96PU8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_996735

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin C (phospho Ser275) Antibody
A8334-01 50 μL

Cyclin C (phospho Ser275) Antibody

Sign In for Pricing
View Details
Cyclin C (phospho Ser275) Antibody
A8334-02 100 µL

Cyclin C (phospho Ser275) Antibody

Sign In for Pricing
View Details
Sema3c (NM_001106578) Rat Tagged ORF Clone Lentiviral Particle
RR209238L4V 200 µL

Sema3c (NM_001106578) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CDC42BPB (CDC42 Binding Protein Kinase beta (DMPK-like), KIAA1124, MRCKB) (FITC)
207534-FITC 100 µL

CDC42BPB (CDC42 Binding Protein Kinase beta (DMPK-like), KIAA1124, MRCKB) (FITC)

Sign In for Pricing
View Details
SLC24A3 sgRNA CRISPR Lentivector (Human) (Target 3)
K2175104 1.0 µg DNA

SLC24A3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
A2LD1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2544886 100 µL

A2LD1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details