Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1R1 Rabbit Polyclonal Antibody (Biotin)

IL1R1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P80, IL1R, IL1RA, CD121A, D2S1473, IL-1R-alpha

UniProt

P14778

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYH

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000868

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

eIF5A2 (Eukaryotic Translation Initiation Factor 5A-2, Eukaryotic Initiation Factor 5A Isoform 2) (MaxLight 650)
MBS6400446-01 0.1 mL

eIF5A2 (Eukaryotic Translation Initiation Factor 5A-2, Eukaryotic Initiation Factor 5A Isoform 2) (MaxLight 650)

Sign In for Pricing
View Details
eIF5A2 (Eukaryotic Translation Initiation Factor 5A-2, Eukaryotic Initiation Factor 5A Isoform 2) (MaxLight 650)
MBS6400446-02 5x 0.1 mL

eIF5A2 (Eukaryotic Translation Initiation Factor 5A-2, Eukaryotic Initiation Factor 5A Isoform 2) (MaxLight 650)

Sign In for Pricing
View Details
Human SGK1 Affinity Purified Polyclonal Ab
AF3200-SP 25 µg

Human SGK1 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
ETFA Antibody
OACD03295-1ML 1 mL

ETFA Antibody

Sign In for Pricing
View Details
GFER, CT (GFER, ALR, HERV1, HPO, FAD-linked sulfhydryl oxidase ALR, Augmenter of liver regeneration, Hepatopoietin)
MBS6010743-01 0.2 mL

GFER, CT (GFER, ALR, HERV1, HPO, FAD-linked sulfhydryl oxidase ALR, Augmenter of liver regeneration, Hepatopoietin)

Sign In for Pricing
View Details
GFER, CT (GFER, ALR, HERV1, HPO, FAD-linked sulfhydryl oxidase ALR, Augmenter of liver regeneration, Hepatopoietin)
MBS6010743-02 5x 0.2 mL

GFER, CT (GFER, ALR, HERV1, HPO, FAD-linked sulfhydryl oxidase ALR, Augmenter of liver regeneration, Hepatopoietin)

Sign In for Pricing
View Details