Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1R1 Rabbit Polyclonal Antibody (Biotin)

IL1R1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P80, IL1R, IL1RA, CD121A, D2S1473, IL-1R-alpha

UniProt

P14778

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYH

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000868

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Vesicular stomatitis Indiana virus Matrix protein (M)
RPC22684-01 20 µg

Recombinant Vesicular stomatitis Indiana virus Matrix protein (M)

Sign In for Pricing
View Details
Recombinant Vesicular stomatitis Indiana virus Matrix protein (M)
RPC22684-02 100 µg

Recombinant Vesicular stomatitis Indiana virus Matrix protein (M)

Sign In for Pricing
View Details
Recombinant Vesicular stomatitis Indiana virus Matrix protein (M)
RPC22684-03 1 mg

Recombinant Vesicular stomatitis Indiana virus Matrix protein (M)

Sign In for Pricing
View Details
Human PSA (Free) Matched Antibody Pair Set [ABP-S-07374]
ABP-S-07374 5 Plates

Human PSA (Free) Matched Antibody Pair Set [ABP-S-07374]

Sign In for Pricing
View Details
Neuro-Oncological Ventral Antigen 2 (NOVA2) Antibody
abx114086 100 µL

Neuro-Oncological Ventral Antigen 2 (NOVA2) Antibody

Sign In for Pricing
View Details
BABAM1 Antibody
OC-288-01 50 μL

BABAM1 Antibody

Sign In for Pricing
View Details