Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1R1 Rabbit Polyclonal Antibody (FITC)

IL1R1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P80, IL1R, IL1RA, CD121A, D2S1473, IL-1R-alpha

UniProt

P14778

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYH

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000868

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G9]
TA809138AM 100 µL

ASS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G9]

Sign In for Pricing
View Details
FGD2 Human qPCR Primer Pair (NM_173558)
HP218372 200 Reactions

FGD2 Human qPCR Primer Pair (NM_173558)

Sign In for Pricing
View Details
MAG Recombinant Chimeric Antibody Antibody
HA610340 100 µL

MAG Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Mucin 6 (MUC6) (MUC6/916), CF640R conjugate, 0.1mg/mL
BNC400916-500 1x 500 µL

Mucin 6 (MUC6) (MUC6/916), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human KIFAP3 activation kit by CRISPRa
GA107913 1 Kit

Human KIFAP3 activation kit by CRISPRa

Sign In for Pricing
View Details
p53 (TP53) Human Gene Knockout Kit (CRISPR)
KN200003BN 1 Kit

p53 (TP53) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details