Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF1 Rabbit Polyclonal Antibody (HRP)

EIF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A121, ISO1, SUI1, EIF-1, EIF1A

UniProt

P41567

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005792

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PSMb6 ELISA Kit (Ready to Use)
orb552088-01 48 Tests

Human PSMb6 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human PSMb6 ELISA Kit (Ready to Use)
orb552088-02 96 Tests

Human PSMb6 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
CBP/p300 ligand 5
orb3134741-01 50 mg

CBP/p300 ligand 5

Sign In for Pricing
View Details
CBP/p300 ligand 5
orb3134741-02 10 mg

CBP/p300 ligand 5

Sign In for Pricing
View Details
EphB2 Receptor (Ephrin B2 Receptor) (APC)
E3371-03B-APC 100 µL

EphB2 Receptor (Ephrin B2 Receptor) (APC)

Sign In for Pricing
View Details
Goat Complement 4 (C4) ELISA Kit
MBS285183-01 48 Tests

Goat Complement 4 (C4) ELISA Kit

Sign In for Pricing
View Details