Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROR1 Rabbit Polyclonal Antibody (HRP)

ROR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NTRKR1, dJ537F10.1

UniProt

Q01973

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

104kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005003

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Burkholderia ambifaria NADH-quinone oxidoreductase subunit K (nuoK)
MBS7023947-01 0.02 mg

Recombinant Burkholderia ambifaria NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
Recombinant Burkholderia ambifaria NADH-quinone oxidoreductase subunit K (nuoK)
MBS7023947-02 0.1 mg

Recombinant Burkholderia ambifaria NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
Recombinant Burkholderia ambifaria NADH-quinone oxidoreductase subunit K (nuoK)
MBS7023947-03 5x 0.1 mg

Recombinant Burkholderia ambifaria NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
NEK7 Protein Vector (Human) (pPM-C-His)
PV104169 500 ng

NEK7 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Rat CBb (Complement Factor Bb) ELISA Kit
MBS7616704-01 48 Well

Rat CBb (Complement Factor Bb) ELISA Kit

Sign In for Pricing
View Details
Rat CBb (Complement Factor Bb) ELISA Kit
MBS7616704-02 96 Well

Rat CBb (Complement Factor Bb) ELISA Kit

Sign In for Pricing
View Details