Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD276 Rabbit Polyclonal Antibody (FITC)

CD276 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

B7H3, B7-H3, B7RP-2, 4Ig-B7-H3

UniProt

Q5ZPR3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSD

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079516

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Fruit fly G6P Antibody-FITC Conjugate
DZ41490-FITC 200 µL/Vial

Anti-Fruit fly G6P Antibody-FITC Conjugate

Sign In for Pricing
View Details
Human Myosin Binding Protein C, Cardiac (MYBPC3) ELISA Kit
MBS167099-01 48 Well

Human Myosin Binding Protein C, Cardiac (MYBPC3) ELISA Kit

Sign In for Pricing
View Details
Human Myosin Binding Protein C, Cardiac (MYBPC3) ELISA Kit
MBS167099-02 96 Well

Human Myosin Binding Protein C, Cardiac (MYBPC3) ELISA Kit

Sign In for Pricing
View Details
Human Myosin Binding Protein C, Cardiac (MYBPC3) ELISA Kit
MBS167099-03 5x 96 Well

Human Myosin Binding Protein C, Cardiac (MYBPC3) ELISA Kit

Sign In for Pricing
View Details
Human Myosin Binding Protein C, Cardiac (MYBPC3) ELISA Kit
MBS167099-04 10x 96 Well

Human Myosin Binding Protein C, Cardiac (MYBPC3) ELISA Kit

Sign In for Pricing
View Details
Human CD300A siRNA
abx910993-01 15 nmol

Human CD300A siRNA

Sign In for Pricing
View Details