Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIPR Rabbit Polyclonal Antibody (HRP)

GIPR Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PGQTL2

UniProt

P48546

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQVMYTVGYS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000155

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinoid X Receptor alpha (RXRA) Rabbit Polyclonal Antibody
TA338248 100 µL

Retinoid X Receptor alpha (RXRA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3'-O- (2-Nitrobenzyl) -dATP 100mM Sodium Solution
dNTP042-0.1 100 µL

3'-O- (2-Nitrobenzyl) -dATP 100mM Sodium Solution

Sign In for Pricing
View Details
Mouse C type lectin domain family 3 member A (CLEC3A) ELISA kit
GTR10446996 96 Well

Mouse C type lectin domain family 3 member A (CLEC3A) ELISA kit

Sign In for Pricing
View Details
VNN3 3'UTR GFP Stable Cell Line
TU078271 1.0 mL

VNN3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rsph6a (NM_001159671) Mouse Tagged ORF Clone
MR222047 10 µg

Rsph6a (NM_001159671) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
IgG Fc monoclonal antibody
orb1726058-01 50 µL

IgG Fc monoclonal antibody

Sign In for Pricing
View Details