Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIPR Rabbit Polyclonal Antibody (HRP)

GIPR Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PGQTL2

UniProt

P48546

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQVMYTVGYS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000155

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klhl23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3625706 1.0 µg DNA

Klhl23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Human SOCS4 shRNA Plasmid
abx964712-01 150 µg

Human SOCS4 shRNA Plasmid

Sign In for Pricing
View Details
Human SOCS4 shRNA Plasmid
abx964712-02 300 µg

Human SOCS4 shRNA Plasmid

Sign In for Pricing
View Details
Nqo1 sgRNA CRISPR Lentivector set (Rat)
K7530801 3x 1.0 µg

Nqo1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Cdk8 (Cyclin-dependent Kinase 8, Cdk 8, Cell Division Protein Kinase 8, K35, Mediator Complex Subunit CDK8, MGC126074, MGC126075, Protein Kinase K35) (AP) discontinued
C2578-05-AP 100 µL

Cdk8 (Cyclin-dependent Kinase 8, Cdk 8, Cell Division Protein Kinase 8, K35, Mediator Complex Subunit CDK8, MGC126074, MGC126075, Protein Kinase K35) (AP) discontinued

Sign In for Pricing
View Details
Mouse Elastase 4 (ELA4) ELISA Kit
MBS2022844-01 24 Strip Well

Mouse Elastase 4 (ELA4) ELISA Kit

Sign In for Pricing
View Details