Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FUT3 Rabbit Polyclonal Antibody (Biotin)

FUT3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LE, Les, FT3B, CD174, FucT-III

UniProt

P21217

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_000140

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin D Recombinant Mouse Monoclonal Antibody [13F4-R]
EM1901-03 100 µL

Cathepsin D Recombinant Mouse Monoclonal Antibody [13F4-R]

Sign In for Pricing
View Details
Human C2CD4D activation kit by CRISPRa
GA119196 1 Kit

Human C2CD4D activation kit by CRISPRa

Sign In for Pricing
View Details
Wdfy2 Mouse Gene Knockout Kit (CRISPR)
KN519331 1 Kit

Wdfy2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDZ and LIM Domain 1 (CPTC-PDLIM1-1), CF594 conjugate, 0.1mg/mL
BNC942272-100 1x 100 µL

PDZ and LIM Domain 1 (CPTC-PDLIM1-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cathepsin B (CTSB) (NM_147780) Human Over-expression Lysate
LY430182 100 µg

Cathepsin B (CTSB) (NM_147780) Human Over-expression Lysate

Sign In for Pricing
View Details
GFAP (GA-5), CF647 conjugate, 0.1mg/mL
BNC470167-100 1x 100 µL

GFAP (GA-5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details