Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYDGF Rabbit Polyclonal Antibody (Biotin)

MYDGF Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IL25, IL27, SF20, IL27w, C19orf10, R33729_1, EUROIMAGE1875335

UniProt

Q969H8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLLGAVALRPAEAVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_061980

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Lipase, LPS ELISA Kit
MBS7219588-01 48 Well

Sheep Lipase, LPS ELISA Kit

Sign In for Pricing
View Details
Sheep Lipase, LPS ELISA Kit
MBS7219588-02 96 Well

Sheep Lipase, LPS ELISA Kit

Sign In for Pricing
View Details
Sheep Lipase, LPS ELISA Kit
MBS7219588-03 5x 96 Well

Sheep Lipase, LPS ELISA Kit

Sign In for Pricing
View Details
Sheep Lipase, LPS ELISA Kit
MBS7219588-04 10x 96 Well

Sheep Lipase, LPS ELISA Kit

Sign In for Pricing
View Details
Anti-Human CD40 Monoclonal Antibody PE Conjugated, Flow Validated
FC00068-PE-01 100 Tests

Anti-Human CD40 Monoclonal Antibody PE Conjugated, Flow Validated

Sign In for Pricing
View Details
Anti-Human CD40 Monoclonal Antibody PE Conjugated, Flow Validated
FC00068-PE-02 200 Tests

Anti-Human CD40 Monoclonal Antibody PE Conjugated, Flow Validated

Sign In for Pricing
View Details