Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stim2 Rabbit Polyclonal Antibody (Biotin)

Stim2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Stim2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IFSPASRVYNGILEKSCSMHQLSSGIPVPHPRHTSCSSAGNDSKPVQEAS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001074572

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Homeobox protein Nkx-2.1 Mouse mAb
MBS435277-01 0.05 mL

Homeobox protein Nkx-2.1 Mouse mAb

Sign In for Pricing
View Details
Homeobox protein Nkx-2.1 Mouse mAb
MBS435277-02 0.1 mL

Homeobox protein Nkx-2.1 Mouse mAb

Sign In for Pricing
View Details
Homeobox protein Nkx-2.1 Mouse mAb
MBS435277-03 5x 0.1 mL

Homeobox protein Nkx-2.1 Mouse mAb

Sign In for Pricing
View Details
Human SLC36A4 qPCR Primer Pair
QH60585S 200 Tests

Human SLC36A4 qPCR Primer Pair

Sign In for Pricing
View Details
CCN1 (CYR61) (NM_001554) Human Over-expression Lysate
LS003491-20ug 20 µg

CCN1 (CYR61) (NM_001554) Human Over-expression Lysate

Sign In for Pricing
View Details
3-Hydroxyglutaric acid dimethyl ester
279421-01 500 mg

3-Hydroxyglutaric acid dimethyl ester

Sign In for Pricing
View Details