Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stim2 Rabbit Polyclonal Antibody (FITC)

Stim2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Stim2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IFSPASRVYNGILEKSCSMHQLSSGIPVPHPRHTSCSSAGNDSKPVQEAS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001074572

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Rwdd3 Pre-designed siRNA Set A
SI112402A 1 Each

Mouse Rwdd3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Integracin A
MBS5787815 Inquire

Integracin A

Sign In for Pricing
View Details
CXCL5 antibody (HRP)
MBS5310614-01 0.1 mg

CXCL5 antibody (HRP)

Sign In for Pricing
View Details
CXCL5 antibody (HRP)
MBS5310614-02 5x 0.1 mg

CXCL5 antibody (HRP)

Sign In for Pricing
View Details
Human Mevalonate Decarboxylase (MVD) ELISA Kit
BSKH63881-01 48 Tests

Human Mevalonate Decarboxylase (MVD) ELISA Kit

Sign In for Pricing
View Details
Human Mevalonate Decarboxylase (MVD) ELISA Kit
BSKH63881-02 96 Tests

Human Mevalonate Decarboxylase (MVD) ELISA Kit

Sign In for Pricing
View Details