Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMO Rabbit Polyclonal Antibody (FITC)

KMO Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DJ317G22.1

UniProt

O15229

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human KMO

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFD

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-2), CF568 conjugate, 0.1mg/mL
BNC682592-100 1x 100 µL

Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phenoxy-d5-acetic Acid
TRC-P318102-5MG 5 mg

Phenoxy-d5-acetic Acid

Sign In for Pricing
View Details
Human S100A12 (S100 Calcium Binding Protein A12) ELISA Kit
E-EL-H6289-01 24 Tests

Human S100A12 (S100 Calcium Binding Protein A12) ELISA Kit

Sign In for Pricing
View Details
Human S100A12 (S100 Calcium Binding Protein A12) ELISA Kit
E-EL-H6289-02 48 Tests

Human S100A12 (S100 Calcium Binding Protein A12) ELISA Kit

Sign In for Pricing
View Details
Human S100A12 (S100 Calcium Binding Protein A12) ELISA Kit
E-EL-H6289-03 96 Tests

Human S100A12 (S100 Calcium Binding Protein A12) ELISA Kit

Sign In for Pricing
View Details
ONX 0914
TRC-O658000-5MG 5 mg

ONX 0914

Sign In for Pricing
View Details