Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMAA Rabbit Polyclonal Antibody (HRP)

MMAA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CblA

UniProt

Q8IVH4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GQRACLAEAITLVESTHSRKKELAQVLLQKVLLYHREQEQSNKGKPLAFR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_758454

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Epididymal Secretory Glutathione Peroxidase (GPX5) ELISA Kit
MBS9393287-01 48 Well

Human Epididymal Secretory Glutathione Peroxidase (GPX5) ELISA Kit

Sign In for Pricing
View Details
Human Epididymal Secretory Glutathione Peroxidase (GPX5) ELISA Kit
MBS9393287-02 96 Well

Human Epididymal Secretory Glutathione Peroxidase (GPX5) ELISA Kit

Sign In for Pricing
View Details
Human Epididymal Secretory Glutathione Peroxidase (GPX5) ELISA Kit
MBS9393287-03 5x 96 Well

Human Epididymal Secretory Glutathione Peroxidase (GPX5) ELISA Kit

Sign In for Pricing
View Details
Human Epididymal Secretory Glutathione Peroxidase (GPX5) ELISA Kit
MBS9393287-04 10x 96 Well

Human Epididymal Secretory Glutathione Peroxidase (GPX5) ELISA Kit

Sign In for Pricing
View Details
IACS-8968 S-enantiomer 50mg
A21559-50 50 mg

IACS-8968 S-enantiomer 50mg

Sign In for Pricing
View Details
HSPA1A Rabbit Monoclonal Antibody [Clone ID: cmhsp70.1 (C92F3B1)]
TA399830 0.2 mg

HSPA1A Rabbit Monoclonal Antibody [Clone ID: cmhsp70.1 (C92F3B1)]

Sign In for Pricing
View Details