Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX1 Rabbit Polyclonal Antibody (HRP)

SNX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

VPS5, HsT17379

UniProt

Q13596

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EDIFTGAAVVSKHQSPKITTSLLPINNGSKENGIHEEQDQEPQDLFADAT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001229862

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm650 Mouse siRNA Oligo Duplex (Locus ID 667383)
SR414977 1 Kit

Gm650 Mouse siRNA Oligo Duplex (Locus ID 667383)

Sign In for Pricing
View Details
CDC42 (Cell Division Control Protein 42 Homolog, G25K GTP-binding Protein) (MaxLight 650)
MBS6373463-01 0.1 mL

CDC42 (Cell Division Control Protein 42 Homolog, G25K GTP-binding Protein) (MaxLight 650)

Sign In for Pricing
View Details
CDC42 (Cell Division Control Protein 42 Homolog, G25K GTP-binding Protein) (MaxLight 650)
MBS6373463-02 5x 0.1 mL

CDC42 (Cell Division Control Protein 42 Homolog, G25K GTP-binding Protein) (MaxLight 650)

Sign In for Pricing
View Details
PIAS3 Antibody
5745-002mg 0.02 mg

PIAS3 Antibody

Sign In for Pricing
View Details
ABL1/2 (phospho-Tyr393/429) Antibody
E011530-2 100 µg -100 µL

ABL1/2 (phospho-Tyr393/429) Antibody

Sign In for Pricing
View Details
SPATA2L Mouse Monoclonal Antibody [Clone ID: OTI2E2]
TA802375 100 µL

SPATA2L Mouse Monoclonal Antibody [Clone ID: OTI2E2]

Sign In for Pricing
View Details