Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PROKR2 Rabbit Polyclonal Antibody (Biotin)

PROKR2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HH3, KAL3, PKR2, GPRg2, GPR73b, GPR73L1, dJ680N4.3

UniProt

Q8NFJ6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CFVTVKNNTMKYFKKMMLLHWRPSQRGSKSSADLDLRTNGVPTTEEVDCI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_658986

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLX4/BTBD12 Rabbit Polyclonal Antibody (Cy5)
orb972135 100 µL

SLX4/BTBD12 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
N6AMT1 3'UTR Luciferase Stable Cell Line
TU015155 1.0 mL

N6AMT1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Tubastatin A
C13155-50mg 50 mg

Tubastatin A

Sign In for Pricing
View Details
HSP27 (Ser82) (Heat Shock Protein beta-1, HspB1, Heat Shock 27kD Protein, HSP 27, Stress-responsive Protein 27, SRP27, Estrogen-regulated 24kD Protein, 28kD Heat Shock Protein, HSPB1, HSP28) (Biotin) discontinued
H1830-53P-Biotin 200 µL

HSP27 (Ser82) (Heat Shock Protein beta-1, HspB1, Heat Shock 27kD Protein, HSP 27, Stress-responsive Protein 27, SRP27, Estrogen-regulated 24kD Protein, 28kD Heat Shock Protein, HSPB1, HSP28) (Biotin) discontinued

Sign In for Pricing
View Details
Vitamin H
V03240-01 1 g

Vitamin H

Sign In for Pricing
View Details
Vitamin H
V03240-02 5 g

Vitamin H

Sign In for Pricing
View Details