Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOS1AP Rabbit Polyclonal Antibody (HRP)

NOS1AP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAPON, NPHS22, 6330408P19Rik

UniProt

O75052

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWSQEELP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

BAA32309

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G2E3, ID (G2E3, KIAA1333, G2/M phase-specific E3 ubiquitin-protein ligase) (FITC)
MBS6300634-01 0.2 mL

G2E3, ID (G2E3, KIAA1333, G2/M phase-specific E3 ubiquitin-protein ligase) (FITC)

Sign In for Pricing
View Details
G2E3, ID (G2E3, KIAA1333, G2/M phase-specific E3 ubiquitin-protein ligase) (FITC)
MBS6300634-02 5x 0.2 mL

G2E3, ID (G2E3, KIAA1333, G2/M phase-specific E3 ubiquitin-protein ligase) (FITC)

Sign In for Pricing
View Details
Pesticide Std 14-Phenylenediamine 2000ug/mL in MeOH - 1ML
REPET303 1 mL

Pesticide Std 14-Phenylenediamine 2000ug/mL in MeOH - 1ML

Sign In for Pricing
View Details
Rabbit Aβ1-40 (Amyloid Beta 1-40) ValidElisa Kit
EK346027 96 Well

Rabbit Aβ1-40 (Amyloid Beta 1-40) ValidElisa Kit

Sign In for Pricing
View Details
AGRN Polyclonal Antibody
MBS2516451-01 0.02 mL

AGRN Polyclonal Antibody

Sign In for Pricing
View Details
AGRN Polyclonal Antibody
MBS2516451-02 0.06 mL

AGRN Polyclonal Antibody

Sign In for Pricing
View Details