Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL19 Rabbit Polyclonal Antibody (Biotin)

IL19 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MDA1, NG.1, ZMDA1, IL-10C

UniProt

Q5VUT3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_715639

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANE1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0084508 1.0 µg DNA

ANE1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Annexin A10 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-5127R-BF488-TR 20 µL

Annexin A10 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
TTC23 (NM_022905) Human Tagged ORF Clone
RC211456 10 µg

TTC23 (NM_022905) Human Tagged ORF Clone

Sign In for Pricing
View Details
PIC 1802-100*100-B7541-RLL-C Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)
814024 250 Roll (250 Label (s) x 1 Roll)

PIC 1802-100*100-B7541-RLL-C Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)

Sign In for Pricing
View Details
FAM20A Recombinant Protein (Human)
RP011491 100 µg

FAM20A Recombinant Protein (Human)

Sign In for Pricing
View Details
MYLK Rabbit pAb
E2508041 100 µL

MYLK Rabbit pAb

Sign In for Pricing
View Details