Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL19 Rabbit Polyclonal Antibody (HRP)

IL19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MDA1, NG.1, ZMDA1, IL-10C

UniProt

Q5VUT3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_715639

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Polyclonal Blooms Syndrome Protein Blm Antibody [Janelia Fluor 549]
NB100-324JF549 0.1 mL

Goat Polyclonal Blooms Syndrome Protein Blm Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
CCDC121 Protein Vector (Human) (pPB-C-His)
PV007805 500 ng

CCDC121 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Human GPX1 Protein
E30P11196 20 µg

Recombinant Human GPX1 Protein

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0060 membrane protein KPN78578_15550 (KPN78578_15550), partial
MBS7064968 Inquire

Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0060 membrane protein KPN78578_15550 (KPN78578_15550), partial

Sign In for Pricing
View Details
Paper filter disc diam.55mm medium slow quantitative 40 7,0um retention GVS 100 pc
FP055DMS40QANC01 100 Pieces/Case:100 Pieces/ PACKS:1 PACKS/CASE

Paper filter disc diam.55mm medium slow quantitative 40 7,0um retention GVS 100 pc

Sign In for Pricing
View Details
Calcein, AM/PI Double Staining Kit, 1 pack = 1000 T
BAL430 1 Pack

Calcein, AM/PI Double Staining Kit, 1 pack = 1000 T

Sign In for Pricing
View Details