Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GGA2 Rabbit Polyclonal Antibody (HRP)

GGA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

VEAR

UniProt

Q9UJY4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GGA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055859

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Apoc4/Apolipoprotein C-IV ELISA Kit
orb1661336 96 Tests

Rat Apoc4/Apolipoprotein C-IV ELISA Kit

Sign In for Pricing
View Details
CABP7 Rabbit pAb
orb2713963-01 50 µL

CABP7 Rabbit pAb

Sign In for Pricing
View Details
CABP7 Rabbit pAb
orb2713963-02 100 µL

CABP7 Rabbit pAb

Sign In for Pricing
View Details
Interleukin 8 (IL-8, 3-10C, AMCF-I, b-ENAP, CXCL8, C-X-C Motif Chemokine 8, Emoctakin, GCP1, GCP-1, Granulocyte Chemotactic Protein 1, K60, LECT, LUCT, LYNAP, MDNCF, MONAP, Monocyte-derived Neutrophil-activating Peptide, Monocyte-derived Neutrophil chemotactic Factor, NAF, NAP1, NAP-1, Neutrophil-activating Protein 1, Protein 3-10C, SCYB8, T-cell Chemotactic Factor, TSG-1) (MaxLight 405) discontinued
I8430-03L-ML405 100 µL

Interleukin 8 (IL-8, 3-10C, AMCF-I, b-ENAP, CXCL8, C-X-C Motif Chemokine 8, Emoctakin, GCP1, GCP-1, Granulocyte Chemotactic Protein 1, K60, LECT, LUCT, LYNAP, MDNCF, MONAP, Monocyte-derived Neutrophil-activating Peptide, Monocyte-derived Neutrophil chemotactic Factor, NAF, NAP1, NAP-1, Neutrophil-activating Protein 1, Protein 3-10C, SCYB8, T-cell Chemotactic Factor, TSG-1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
MARCH3 Rabbit Polyclonal Antibody (AP)
orb973505 100 µL

MARCH3 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Recombinant Human Vitamin D-Binding Protein/VDB/Gc-globulin Protein (C-6His)
MBS2553376-01 0.01 mg

Recombinant Human Vitamin D-Binding Protein/VDB/Gc-globulin Protein (C-6His)

Sign In for Pricing
View Details