Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD84 Rabbit Polyclonal Antibody (FITC)

CD84 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LY9B, hCD84, mCD84, SLAMF5

UniProt

Q9UIB8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYDEILQ

Field of Research

Immunology & Inflammation; Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001171811

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KRTAP21-1 knockout cell line
ABC-KH8190 1 Vial

Human KRTAP21-1 knockout cell line

Sign In for Pricing
View Details
NDUFB9 (D-7) : m-IgG Fc BP-HRP Bundle
sc-527827 1 Kit

NDUFB9 (D-7) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
ORC1L (Origin Recognition Complex Subunit 1, Replication Control Protein 1, ORC1, PARC1)
130735 100 µg

ORC1L (Origin Recognition Complex Subunit 1, Replication Control Protein 1, ORC1, PARC1)

Sign In for Pricing
View Details
NEURL sgRNA CRISPR Lentivector set (Human)
K1418601 3x 1.0 µg

NEURL sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily Member 11, TNFSF11 Primacu™ ELISA Kit
BPE215-01 96 Tests

Human Tumor Necrosis Factor Ligand Superfamily Member 11, TNFSF11 Primacu™ ELISA Kit

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily Member 11, TNFSF11 Primacu™ ELISA Kit
BPE215-02 5x 96 Tests

Human Tumor Necrosis Factor Ligand Superfamily Member 11, TNFSF11 Primacu™ ELISA Kit

Sign In for Pricing
View Details