Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CERK Rabbit Polyclonal Antibody (Biotin)

CERK Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LK4, hCERK, dA59H18.2, dA59H18.3

UniProt

Q8TCT0

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PSCCCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGIEENPKPDSHS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_073603

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse DediCator of cytokinesis protein 6, DOCK6 ELISA Kit
MBS9317671-01 48 Well

Mouse DediCator of cytokinesis protein 6, DOCK6 ELISA Kit

Sign In for Pricing
View Details
Mouse DediCator of cytokinesis protein 6, DOCK6 ELISA Kit
MBS9317671-02 96 Well

Mouse DediCator of cytokinesis protein 6, DOCK6 ELISA Kit

Sign In for Pricing
View Details
Mouse DediCator of cytokinesis protein 6, DOCK6 ELISA Kit
MBS9317671-03 5x 96 Well

Mouse DediCator of cytokinesis protein 6, DOCK6 ELISA Kit

Sign In for Pricing
View Details
Mouse DediCator of cytokinesis protein 6, DOCK6 ELISA Kit
MBS9317671-04 10x 96 Well

Mouse DediCator of cytokinesis protein 6, DOCK6 ELISA Kit

Sign In for Pricing
View Details
Human Factor Related Apoptosis Ligand CLIA Kit
MBS8425403-01 1 Kit

Human Factor Related Apoptosis Ligand CLIA Kit

Sign In for Pricing
View Details
Human Factor Related Apoptosis Ligand CLIA Kit
MBS8425403-02 5x 1 Kit

Human Factor Related Apoptosis Ligand CLIA Kit

Sign In for Pricing
View Details