Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CERK Rabbit Polyclonal Antibody (FITC)

CERK Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LK4, hCERK, dA59H18.2, dA59H18.3

UniProt

Q8TCT0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CERK

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_073603

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human LYVE1 (Lymphatic vessel endothelial hyaluronan receptor 1) for Antibody Discovery
MP0154Q Each

Magic™ Membrane Protein Human LYVE1 (Lymphatic vessel endothelial hyaluronan receptor 1) for Antibody Discovery

Sign In for Pricing
View Details
EF-CBP2 Polyclonal Antibody, APC Conjugated
bs-9016R-APC 100 µL

EF-CBP2 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
SWSAP1, Human (His)
HY-P71347-01 10 µg

SWSAP1, Human (His)

Sign In for Pricing
View Details
SWSAP1, Human (His)
HY-P71347-02 50 µg

SWSAP1, Human (His)

Sign In for Pricing
View Details
UCHL1 (Ubiquitin carboxyl-terminal Esterase L1 (Ubiquitin thiolEsterase), PARK5, PGP9.5, Uch-L1) (MaxLight 490)
253247-ML490 100 µL

UCHL1 (Ubiquitin carboxyl-terminal Esterase L1 (Ubiquitin thiolEsterase), PARK5, PGP9.5, Uch-L1) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0115 protein PC1_2813 (PC1_2813)
MBS1190532-01 0.02 mg (E-Coli)

Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0115 protein PC1_2813 (PC1_2813)

Sign In for Pricing
View Details