Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD109 Rabbit Polyclonal Antibody (HRP)

CD109 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P180, r150, CPAMD7

UniProt

Q6YHK3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KLYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMEN

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

151kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001153060

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synapsin I (SYN1) (NM_006950) Human Untagged Clone
SC314473 10 µg

Synapsin I (SYN1) (NM_006950) Human Untagged Clone

Sign In for Pricing
View Details
DLL1 Recombinant Protein
90-123 10 µg

DLL1 Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human CD49B/ITGA2 Protein, His Tag
E40KMH208 20 µg

Recombinant Human CD49B/ITGA2 Protein, His Tag

Sign In for Pricing
View Details
Mmu-miR-698-3p miRNA Antagomir
orb1913422-01 10 nmol

Mmu-miR-698-3p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-698-3p miRNA Antagomir
orb1913422-02 20 nmol

Mmu-miR-698-3p miRNA Antagomir

Sign In for Pricing
View Details
N-Acylethanolamine Acid Amidase (NAAA, ASAHL, PLT, N-Acylethanolamine-Hydrolyzing Acid Amidase, N-Acylsphingosine Amidohydrolase Like)
141594 200 µL

N-Acylethanolamine Acid Amidase (NAAA, ASAHL, PLT, N-Acylethanolamine-Hydrolyzing Acid Amidase, N-Acylsphingosine Amidohydrolase Like)

Sign In for Pricing
View Details