Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF17 Rabbit Polyclonal Antibody (FITC)

FGF17 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HH20, FGF-13, FGF-17

UniProt

O60258

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human FGF17

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003858

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Coagulation Factor II ELISA Kit
MBS741392-01 48 Well

Monkey Coagulation Factor II ELISA Kit

Sign In for Pricing
View Details
Monkey Coagulation Factor II ELISA Kit
MBS741392-02 96 Well

Monkey Coagulation Factor II ELISA Kit

Sign In for Pricing
View Details
Monkey Coagulation Factor II ELISA Kit
MBS741392-03 5x 96 Well

Monkey Coagulation Factor II ELISA Kit

Sign In for Pricing
View Details
Monkey Coagulation Factor II ELISA Kit
MBS741392-04 10x 96 Well

Monkey Coagulation Factor II ELISA Kit

Sign In for Pricing
View Details
TRNAE34P Protein Vector (Human) (pPM-C-HA)
PV138680 500 ng

TRNAE34P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Goat Beta-secretase 2 (BACE2) ELISA Kit
MBS7233461-01 48 Well

Goat Beta-secretase 2 (BACE2) ELISA Kit

Sign In for Pricing
View Details