Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPBAR1 Rabbit Polyclonal Antibody (FITC)

GPBAR1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BG37, TGR5, M-BAR, GPCR19, GPR131

UniProt

Q8TDU6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_733800

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCY10 (NM_018417) Human Tagged ORF Clone
RC214876 10 µg

ADCY10 (NM_018417) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal HSPH1/HSP105 Antibody [Alexa Fluor 488]
NBP2-97291AF488 0.1 mL

Rabbit Polyclonal HSPH1/HSP105 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Brpf3-set siRNA/shRNA/RNAi Lentivector (Rat)
13490096 4x 500 ng

Brpf3-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
RGS11, ID (RGS11, Regulator of G-protein signaling 11) (PE) discontinued
041003-PE 200 µL

RGS11, ID (RGS11, Regulator of G-protein signaling 11) (PE) discontinued

Sign In for Pricing
View Details
OR4X1, NT (OR4X1, Olfactory receptor 4X1, Olfactory receptor OR11-104) (FITC)
MBS6328924-01 0.2 mL

OR4X1, NT (OR4X1, Olfactory receptor 4X1, Olfactory receptor OR11-104) (FITC)

Sign In for Pricing
View Details
OR4X1, NT (OR4X1, Olfactory receptor 4X1, Olfactory receptor OR11-104) (FITC)
MBS6328924-02 5x 0.2 mL

OR4X1, NT (OR4X1, Olfactory receptor 4X1, Olfactory receptor OR11-104) (FITC)

Sign In for Pricing
View Details