Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUMF1 Rabbit Polyclonal Antibody (Biotin)

SUMF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FGE, UNQ3037, AAPA3037

UniProt

Q8NBK3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYC

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_877437

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTSL1P2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV759417 1.0 µg DNA

CTSL1P2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
SRSF10 ORF Vector (Human) (pORF)
ORF033376 1.0 µg DNA

SRSF10 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
RPS10P20 sgRNA CRISPR Lentivector (Human) (Target 2)
K2022403 1.0 µg DNA

RPS10P20 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Egr-4 HDR Plasmid (h)
sc-403343-HDR 20 µg

Egr-4 HDR Plasmid (h)

Sign In for Pricing
View Details
CD36, ID (CD36, GP3B, GP4, Platelet glycoprotein 4, Fatty acid translocase, Glycoprotein IIIb, Leukocyte differentiation antigen CD36, PAS IV, PAS-4, Platelet collagen receptor, Platelet glycoprotein IV, Thrombospondin receptor, CD36) (FITC) discontinued
033499-FITC 200 µL

CD36, ID (CD36, GP3B, GP4, Platelet glycoprotein 4, Fatty acid translocase, Glycoprotein IIIb, Leukocyte differentiation antigen CD36, PAS IV, PAS-4, Platelet collagen receptor, Platelet glycoprotein IV, Thrombospondin receptor, CD36) (FITC) discontinued

Sign In for Pricing
View Details
TP53I11 Conjugated Antibody
orb1623985 100 µL

TP53I11 Conjugated Antibody

Sign In for Pricing
View Details