Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYO10 Rabbit Polyclonal Antibody (Biotin)

MYO10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8NCI3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTTRSASSQGSSR

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

BAC11158

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGAP25 (NM_001166277) Human Over-expression Lysate
LC431525 20 µg

ARHGAP25 (NM_001166277) Human Over-expression Lysate

Sign In for Pricing
View Details
ZAP70 pTyr493 Rabbit Polyclonal Antibody
AP20821PU-N 100 µg

ZAP70 pTyr493 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Angiotensin Converting Enzyme 1 (ACE) (C-term) Rabbit Polyclonal Antibody
AP14588PU-N 400 µL

Angiotensin Converting Enzyme 1 (ACE) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF488A conjugate, 0.1mg/mL
BNC881786-100 1x 100 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LDHA Recombinant Rabbit monoclonal Antibody
HA723547 100 µL

LDHA Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD79a (HM47/A9), CF647 conjugate, 0.1mg/mL
BNC470477-500 1x 500 µL

CD79a (HM47/A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details