Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYO10 Rabbit Polyclonal Antibody (HRP)

MYO10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8NCI3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTTRSASSQGSSR

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

BAC11158

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100P Rabbit Polyclonal Antibody
TA364993 100 µL

S100P Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
o-Toluic-D7 Acid
TRC-T536123-250MG 250 mg

o-Toluic-D7 Acid

Sign In for Pricing
View Details
Thrombin Receptor (F2R) Mouse Monoclonal Antibody [Clone ID: 6A7H10]
AM06270SU-N 100 µL

Thrombin Receptor (F2R) Mouse Monoclonal Antibody [Clone ID: 6A7H10]

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2682R), CF405S conjugate, 0.1mg/mL
BNC042682-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2682R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bulk Anti-Human CD19 (SJ25-C1) Antibody
ICH1011-25mg 25 mg

Bulk Anti-Human CD19 (SJ25-C1) Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]
E-AB-F1093UC-01 25 µg

FITC Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]

Sign In for Pricing
View Details