Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNC13D Rabbit Polyclonal Antibody (FITC)

UNC13D Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FHL3, HLH3, HPLH3, Munc13-4

UniProt

Q70J99

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human UNC13D

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SGSEEPGEVPQTRLPLTYPAPNGDPILQLLEGRKGDREAQVFVRLRRHRA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

119kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_954712

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clnk Mouse shRNA Lentiviral Particle (Locus ID 27278)
TL502686V 500 µL Each

Clnk Mouse shRNA Lentiviral Particle (Locus ID 27278)

Sign In for Pricing
View Details
Monoclonal Antibody to Stearoyl Coenzyme A Desaturase (SCD)
TRV-0059871-01 20 µL

Monoclonal Antibody to Stearoyl Coenzyme A Desaturase (SCD)

Sign In for Pricing
View Details
Monoclonal Antibody to Stearoyl Coenzyme A Desaturase (SCD)
TRV-0059871-02 100 µL

Monoclonal Antibody to Stearoyl Coenzyme A Desaturase (SCD)

Sign In for Pricing
View Details
Monoclonal Antibody to Stearoyl Coenzyme A Desaturase (SCD)
TRV-0059871-03 200 µL

Monoclonal Antibody to Stearoyl Coenzyme A Desaturase (SCD)

Sign In for Pricing
View Details
Monoclonal Antibody to Stearoyl Coenzyme A Desaturase (SCD)
TRV-0059871-04 1 mL

Monoclonal Antibody to Stearoyl Coenzyme A Desaturase (SCD)

Sign In for Pricing
View Details
S100A10 ELISA Kit (Human)
OKEH01947-96W 96 Tests

S100A10 ELISA Kit (Human)

Sign In for Pricing
View Details